SCOP 1.69: Domain d1himl2: 1him L:113-228

Lineage for d1himl2 (1him L:113-228)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1himl2: 1him L:113-228 [20902]
   Other proteins in same PDB: d1himh1, d1himh2, d1himj1, d1himj2, d1himl1, d1himm1

Details for d1himl2

PDB Entry: 1him, 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition

SCOP Domain Sequences for d1himl2:

Sequence, based on SEQRES records:

>d1himl2 b.1.1.2 (L:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records):

>d1himl2 b.1.1.2 (L:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1himl2:

• d1himl2 first appeared (with stable ids) in SCOP 1.55
  
• d1himl2 appears in SCOP 1.67
  
• d1himl2 appears in SCOP 1.71
  
• d1himl2 appears in the current release, SCOPe 2.08