Lineage for d1himl2 (1him L:113-228)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365413Domain d1himl2: 1him L:113-228 [20902]
    Other proteins in same PDB: d1himh1, d1himh2, d1himj1, d1himj2, d1himl1, d1himm1

Details for d1himl2

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition
PDB Compounds: (L:)

SCOP Domain Sequences for d1himl2:

Sequence, based on SEQRES records: (download)

>d1himl2 b.1.1.2 (L:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1himl2 b.1.1.2 (L:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1himl2:

Click to download the PDB-style file with coordinates for d1himl2.
(The format of our PDB-style files is described here.)

Timeline for d1himl2: