SCOP 1.61: Domain d1himl2: 1him L:109-228

Lineage for d1himl2 (1him L:109-228)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries)
Domain d1himl2: 1him L:109-228 [20902]
Other proteins in same PDB: d1himh1, d1himj1, d1himl1, d1himm1

Details for d1himl2

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition

SCOP Domain Sequences for d1himl2:

Sequence, based on SEQRES records: (download)

>d1himl2 b.1.1.2 (L:109-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
vtvsaakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpa
vlqsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1himl2 b.1.1.2 (L:109-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
vtvsaakttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1himl2:

Click to download the PDB-style file with coordinates for d1himl2.
(The format of our PDB-style files is described here.)

Timeline for d1himl2: