| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries) |
| Domain d1himl2: 1him L:109-228 [20902] Other proteins in same PDB: d1himh1, d1himj1, d1himl1, d1himm1 |
PDB Entry: 1him (more details), 2.9 Å
SCOP Domain Sequences for d1himl2:
Sequence, based on SEQRES records: (download)
>d1himl2 b.1.1.2 (L:109-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
vtvsaakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpa
vlqsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
>d1himl2 b.1.1.2 (L:109-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
vtvsaakttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1himl2: