Lineage for d1ifhh2 (1ifh H:113-228)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655588Domain d1ifhh2: 1ifh H:113-228 [20901]
    Other proteins in same PDB: d1ifhh1, d1ifhl1, d1ifhl2
    part of Fab 17/9

Details for d1ifhh2

PDB Entry: 1ifh (more details), 2.8 Å

PDB Description: a detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
PDB Compounds: (H:) igg2a-kappa 17/9 fab (heavy chain)

SCOP Domain Sequences for d1ifhh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifhh2 b.1.1.2 (H:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1ifhh2:

Click to download the PDB-style file with coordinates for d1ifhh2.
(The format of our PDB-style files is described here.)

Timeline for d1ifhh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ifhh1