Lineage for d3d5tc2 (3d5t C:157-325)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2605462Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2605463Protein automated matches [226850] (47 species)
    not a true protein
  7. 2605533Species Burkholderia pseudomallei [TaxId:320372] [225461] (1 PDB entry)
  8. 2605536Domain d3d5tc2: 3d5t C:157-325 [209007]
    Other proteins in same PDB: d3d5ta1, d3d5tb1, d3d5tc1, d3d5td1
    automated match to d1b8pa2
    complexed with mg, na

Details for d3d5tc2

PDB Entry: 3d5t (more details), 2.51 Å

PDB Description: crystal structure of malate dehydrogenase from burkholderia pseudomallei
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d3d5tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5tc2 d.162.1.0 (C:157-325) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrldhnralsqlaaksgkpvasieklavwgnhsptmypdfrfataegesllklinddvwn
rdtfiptvgkrgaaiiearglssaasaanaaidhvrdwvlgtngkwvtmgipsdgsygip
ediiygvpvicengeykrvegleidafsrekmdgtlaelleerdgvahl

SCOPe Domain Coordinates for d3d5tc2:

Click to download the PDB-style file with coordinates for d3d5tc2.
(The format of our PDB-style files is described here.)

Timeline for d3d5tc2: