![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
![]() | Protein automated matches [226850] (47 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:320372] [225461] (1 PDB entry) |
![]() | Domain d3d5tb2: 3d5t B:157-325 [209005] Other proteins in same PDB: d3d5ta1, d3d5tb1, d3d5tc1, d3d5td1 automated match to d1b8pa2 complexed with mg, na |
PDB Entry: 3d5t (more details), 2.51 Å
SCOPe Domain Sequences for d3d5tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5tb2 d.162.1.0 (B:157-325) automated matches {Burkholderia pseudomallei [TaxId: 320372]} lrldhnralsqlaaksgkpvasieklavwgnhsptmypdfrfataegesllklinddvwn rdtfiptvgkrgaaiiearglssaasaanaaidhvrdwvlgtngkwvtmgipsdgsygip ediiygvpvicengeykrvegleidafsrekmdgtlaelleerdgvahl
Timeline for d3d5tb2: