Lineage for d3d5ta1 (3d5t A:3-156)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830902Species Burkholderia pseudomallei [TaxId:320372] [188646] (5 PDB entries)
  8. 1830912Domain d3d5ta1: 3d5t A:3-156 [209002]
    Other proteins in same PDB: d3d5ta2, d3d5tb2, d3d5tc2, d3d5td2
    automated match to d1b8pa1
    complexed with mg, na

Details for d3d5ta1

PDB Entry: 3d5t (more details), 2.51 Å

PDB Description: crystal structure of malate dehydrogenase from burkholderia pseudomallei
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3d5ta1:

Sequence, based on SEQRES records: (download)

>d3d5ta1 c.2.1.0 (A:3-156) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca
fpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaalnevas
rdvkvlvvgnpantnayiamksapdlpkknftam

Sequence, based on observed residues (ATOM records): (download)

>d3d5ta1 c.2.1.0 (A:3-156) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca
fpllagvvitddpkvafkdadvallvgarprsmerkdllsanaeiftvqgaalnevasrd
vkvlvvgnpantnayiamksapdlpkknftam

SCOPe Domain Coordinates for d3d5ta1:

Click to download the PDB-style file with coordinates for d3d5ta1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ta1: