Lineage for d3d4qa_ (3d4q A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (733 PDB entries)
  8. 2545804Domain d3d4qa_: 3d4q A: [208997]
    automated match to d1i44a_
    complexed with sm5

Details for d3d4qa_

PDB Entry: 3d4q (more details), 2.8 Å

PDB Description: pyrazole-based inhibitors of b-raf kinase
PDB Compounds: (A:) B-Raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d3d4qa_:

Sequence, based on SEQRES records: (download)

>d3d4qa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarslpk

Sequence, based on observed residues (ATOM records): (download)

>d3d4qa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
krderplfpqilasiellarslpk

SCOPe Domain Coordinates for d3d4qa_:

Click to download the PDB-style file with coordinates for d3d4qa_.
(The format of our PDB-style files is described here.)

Timeline for d3d4qa_: