SCOPe 2.08: Domain d3d4pb2: 3d4p B:149-313

Lineage for d3d4pb2 (3d4p B:149-313)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries)

8. Domain d3d4pb2: 3d4p B:149-313 [208996]
   Other proteins in same PDB: d3d4pa1, d3d4pb1
   automated match to d2ldba2
   complexed with nad, pyr

Details for d3d4pb2

PDB Entry: 3d4p, 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase from staphylococcus aureus complexed with nad and pyruvate

PDB Compounds: (B:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3d4pb2:

Sequence; same for both SEQRES and ATOM records:

>d3d4pb2 d.162.1.0 (B:149-313) automated matches {Staphylococcus aureus [TaxId: 93062]}
tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk
aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee
dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimaea

Timeline for d3d4pb2:

• d3d4pb2 first appeared in SCOPe 2.03
  
• d3d4pb2 appears in SCOPe 2.07