Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.0: automated matches [227186] (1 protein) not a true family |
Protein automated matches [226908] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225567] (1 PDB entry) |
Domain d3d4jb2: 3d4j B:194-396 [208992] Other proteins in same PDB: d3d4ja1, d3d4jb1 automated match to d1fi4a2 complexed with so4 |
PDB Entry: 3d4j (more details), 2.4 Å
SCOPe Domain Sequences for d3d4jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d4jb2 d.58.26.0 (B:194-396) automated matches {Human (Homo sapiens) [TaxId: 9606]} elrvlilvvsaekkltgstvgmrasvetspllrfraesvvparmaemarcirerdfpsfa qltmkdsnqfhatcldtfppisylnaiswriihlvhrfnahhgdtkvaytfdagpnavif tlddtvaefvaavwhgfppgsngdtflkglqvrpaplsaelqaalameptpggvkyiivt qvgpgpqilddpcahllgpdglp
Timeline for d3d4jb2: