SCOPe 2.04: Domain d3d4ja2: 3d4j A:194-396

Lineage for d3d4ja2 (3d4j A:194-396)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.0: automated matches [227186] (1 protein)
   not a true family

6. Protein automated matches [226908] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225567] (1 PDB entry)

8. Domain d3d4ja2: 3d4j A:194-396 [208990]
   Other proteins in same PDB: d3d4ja1, d3d4jb1
   automated match to d1fi4a2
   complexed with so4

Details for d3d4ja2

PDB Entry: 3d4j, 2.4 Å

PDB Description: Crystal structure of Human mevalonate diphosphate decarboxylase

PDB Compounds: (A:) Diphosphomevalonate decarboxylase

SCOPe Domain Sequences for d3d4ja2:

Sequence; same for both SEQRES and ATOM records:

>d3d4ja2 d.58.26.0 (A:194-396) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elrvlilvvsaekkltgstvgmrasvetspllrfraesvvparmaemarcirerdfpsfa
qltmkdsnqfhatcldtfppisylnaiswriihlvhrfnahhgdtkvaytfdagpnavif
tlddtvaefvaavwhgfppgsngdtflkglqvrpaplsaelqaalameptpggvkyiivt
qvgpgpqilddpcahllgpdglp

Timeline for d3d4ja2:

• d3d4ja2 first appeared in SCOPe 2.03
  
• d3d4ja2 appears in SCOPe 2.05
  
• d3d4ja2 appears in the current release, SCOPe 2.08