SCOPe 2.06: Domain d3d0za2: 3d0z A:81-214

Lineage for d3d0za2 (3d0z A:81-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Schistosoma japonicum [TaxId:6182] [225615] (2 PDB entries)

8. Domain d3d0za2: 3d0z A:81-214 [208984]
   Other proteins in same PDB: d3d0za1
   automated match to d1bg5a1
   complexed with gsh

Details for d3d0za2

PDB Entry: 3d0z, 2.5 Å

PDB Description: structural charcaterization of an engineered allosteric protein

PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d3d0za2:

Sequence; same for both SEQRES and ATOM records:

>d3d0za2 a.45.1.1 (A:81-214) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggd

Timeline for d3d0za2:

• d3d0za2 first appeared in SCOPe 2.03
  
• d3d0za2 appears in SCOPe 2.05
  
• d3d0za2 appears in SCOPe 2.07
  
• d3d0za2 appears in the current release, SCOPe 2.08