Lineage for d3d0za2 (3d0z A:81-214)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2322548Protein automated matches [226848] (11 species)
    not a true protein
  7. 2322697Species Schistosoma japonicum [TaxId:6182] [225615] (2 PDB entries)
  8. 2322700Domain d3d0za2: 3d0z A:81-214 [208984]
    Other proteins in same PDB: d3d0za1
    automated match to d1bg5a1
    complexed with gsh

Details for d3d0za2

PDB Entry: 3d0z (more details), 2.5 Å

PDB Description: Structural charcaterization of an engineered allosteric protein
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d3d0za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0za2 a.45.1.1 (A:81-214) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggd

SCOPe Domain Coordinates for d3d0za2:

Click to download the PDB-style file with coordinates for d3d0za2.
(The format of our PDB-style files is described here.)

Timeline for d3d0za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d0za1