| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries) |
| Domain d3d0za1: 3d0z A:1-80 [208983] Other proteins in same PDB: d3d0za2 automated match to d1m9aa2 complexed with gsh |
PDB Entry: 3d0z (more details), 2.5 Å
SCOPe Domain Sequences for d3d0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d0za1 c.47.1.0 (A:1-80) automated matches {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelghefpnlpyyid
gdvkltqsmaiiryiadkhn
Timeline for d3d0za1: