| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93062] [225655] (3 PDB entries) |
| Domain d3d0ob1: 3d0o B:4-148 [208981] Other proteins in same PDB: d3d0oa2, d3d0ob2 automated match to d1ldna1 |
PDB Entry: 3d0o (more details), 1.8 Å
SCOPe Domain Sequences for d3d0ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d0ob1 c.2.1.0 (B:4-148) automated matches {Staphylococcus aureus [TaxId: 93062]}
fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
vkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgiflvat
npvdilayatwkfsglpkervigsg
Timeline for d3d0ob1: