Lineage for d3czba_ (3czb A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061142Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2061188Family b.52.1.0: automated matches [227180] (1 protein)
    not a true family
  6. 2061189Protein automated matches [226899] (3 species)
    not a true protein
  7. 2061190Species Caulobacter crescentus [TaxId:190650] [225466] (1 PDB entry)
  8. 2061191Domain d3czba_: 3czb A: [208977]
    automated match to d2pnwa1
    complexed with so4

Details for d3czba_

PDB Entry: 3czb (more details), 2.5 Å

PDB Description: crystal structure of putative transglycosylase from caulobacter crescentus
PDB Compounds: (A:) Putative transglycosylase

SCOPe Domain Sequences for d3czba_:

Sequence, based on SEQRES records: (download)

>d3czba_ b.52.1.0 (A:) automated matches {Caulobacter crescentus [TaxId: 190650]}
mpaalsfaglagwaeedhlaalnafragcgvskdpaaarvcglakatkdldvsgakafie
anfrveavdgggdglltayfapqyearmsrnaefsaplrglpadlvvldlgpfepalvgk
kitghvegstfvpypdraeieatpsdkplawmrpeelfflqiqgsgvlvlpdgrrvravf
agtngkpfvgiaiamrdkgllpdnntsadairtwlaehrgpeadaimrlnpryvffrtvp
ddgkepagaagvalppgraiavdpgyhayggfywldaaapklvgafpvyrravtaldtgg
aikgevradlymgsgavagveagrvrhtlrlyrltpnp

Sequence, based on observed residues (ATOM records): (download)

>d3czba_ b.52.1.0 (A:) automated matches {Caulobacter crescentus [TaxId: 190650]}
mpaalsfaglagwaeedhlaalnafragcgvskdpaaarvcglakatkdldvsgakafie
anfrveavdgggdglltayfapqyearmsrnaefsaplrglpadlvvldlgpfepalvgk
kitghvegstfvpypdraeieatpsdkplawmrpeelfflqiqgsgvlvlpdgrrvravf
agtngkpfvgiaiamrdkglladairtwlaehrgpeadaimrlnpryvffrtvpddgkep
agaagvalppgraiavdpgyhayggfywldaafpvyrravtaldtggaikgevradlymg
sgavagveagrvrhtlrlyrltpnp

SCOPe Domain Coordinates for d3czba_:

Click to download the PDB-style file with coordinates for d3czba_.
(The format of our PDB-style files is described here.)

Timeline for d3czba_: