Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (17 species) not a true protein |
Species Myxococcus xanthus [TaxId:246197] [225453] (1 PDB entry) |
Domain d3cwva2: 3cwv A:207-356 [208973] Other proteins in same PDB: d3cwva1, d3cwvb1 automated match to d1ei1a1 |
PDB Entry: 3cwv (more details), 1.95 Å
SCOPe Domain Sequences for d3cwva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cwva2 d.14.1.0 (A:207-356) automated matches {Myxococcus xanthus [TaxId: 246197]} gvaqwahvltearpqlhpepvvfdftwdglrvqcalqwcededstllsfanavrtvrhga hvkgvtqalrgalaklsgetrgafpwarvaqgltaivavsgprrqmafagptkellaipg leeairkqlqplfiellrehpvtpallarr
Timeline for d3cwva2: