SCOPe 2.04: Domain d3cwva1: 3cwv A:8-206

Lineage for d3cwva1 (3cwv A:8-206)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (11 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:246197] [225452] (1 PDB entry)

8. Domain d3cwva1: 3cwv A:8-206 [208972]
   Other proteins in same PDB: d3cwva2, d3cwvb2
   automated match to d1ei1a2

Details for d3cwva1

PDB Entry: 3cwv, 1.95 Å

PDB Description: crystal structure of b-subunit of the dna gyrase from myxococcus xanthus

PDB Compounds: (A:) DNA gyrase, B subunit, truncated

SCOPe Domain Sequences for d3cwva1:

Sequence; same for both SEQRES and ATOM records:

>d3cwva1 d.122.1.0 (A:8-206) automated matches {Myxococcus xanthus [TaxId: 246197]}
ggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfc
tsrtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadgrqwrvmge
hghpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcnelaalapgl
rvsfadlqrgertlwhlpg

Timeline for d3cwva1:

• d3cwva1 first appeared in SCOPe 2.03
  
• d3cwva1 appears in SCOPe 2.05
  
• d3cwva1 appears in the current release, SCOPe 2.08