Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries) |
Domain d1hilb2: 1hil B:113-228 [20897] Other proteins in same PDB: d1hila1, d1hilb1, d1hilc1, d1hild1 |
PDB Entry: 1hil (more details), 2 Å
SCOP Domain Sequences for d1hilb2:
Sequence, based on SEQRES records: (download)
>d1hilb2 b.1.1.2 (B:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain} aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
>d1hilb2 b.1.1.2 (B:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain} aakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1hilb2: