Lineage for d1hilb2 (1hil B:113-228)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 protein domains)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8657Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries)
  8. 8659Domain d1hilb2: 1hil B:113-228 [20897]
    Other proteins in same PDB: d1hila1, d1hilb1, d1hilc1, d1hild1

Details for d1hilb2

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hilb2:

Sequence, based on SEQRES records: (download)

>d1hilb2 b.1.1.2 (B:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1hilb2 b.1.1.2 (B:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
aakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1hilb2:

Click to download the PDB-style file with coordinates for d1hilb2.
(The format of our PDB-style files is described here.)

Timeline for d1hilb2: