SCOPe 2.07: Domain d3cwea1: 3cwe A:501-783

Lineage for d3cwea1 (3cwe A:501-783)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (263 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d3cwea1: 3cwe A:501-783 [208969]
   Other proteins in same PDB: d3cwea2
   automated match to d2cm2a_
   complexed with 825, mg

Details for d3cwea1

PDB Entry: 3cwe, 1.6 Å

PDB Description: PTP1B in complex with a phosphonic acid inhibitor

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d3cwea1:

Sequence, based on SEQRES records:

>d3cwea1 c.45.1.2 (A:501-783) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

Sequence, based on observed residues (ATOM records):

>d3cwea1 c.45.1.2 (A:501-783) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmkcaqyw
pqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgvp
espasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssvd
ikkvllemrkfrmgliqtadqlrfsylaviegakfimg

Timeline for d3cwea1:

• d3cwea1 first appeared in SCOPe 2.03, called d3cwea_
  
• d3cwea1 appears in SCOPe 2.06
  
• d3cwea1 appears in the current release, SCOPe 2.08