![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) ![]() |
![]() | Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein) |
![]() | Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [140651] (2 PDB entries) Uniprot Q97Z79 85-175 |
![]() | Domain d3cw2g2: 3cw2 G:85-175 [208964] Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c3, d3cw2d1, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g3, d3cw2h1, d3cw2h3 automated match to d2ahob1 |
PDB Entry: 3cw2 (more details), 2.8 Å
SCOPe Domain Sequences for d3cw2g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw2g2 a.60.14.1 (G:85-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]} vtdderrkknlqwkkiqrldkilelvsqklklsekdaweqvawkleakygdpitaiekav kegekilidagvpeiwvkplleeaskhaeer
Timeline for d3cw2g2: