Lineage for d3cw2d3 (3cw2 D:176-266)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562616Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 2562617Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 2562618Protein eIF-2-alpha, C-terminal domain [110995] (2 species)
  7. 2562621Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
    Uniprot Q97Z79 176-264
  8. 2562624Domain d3cw2d3: 3cw2 D:176-266 [208962]
    Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2d1, d3cw2d2, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2h1, d3cw2h2
    automated match to d2ahob3

Details for d3cw2d3

PDB Entry: 3cw2 (more details), 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
PDB Compounds: (D:) Translation initiation factor 2 subunit alpha

SCOPe Domain Sequences for d3cw2d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw2d3 d.58.51.1 (D:176-266) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvvkk

SCOPe Domain Coordinates for d3cw2d3:

Click to download the PDB-style file with coordinates for d3cw2d3.
(The format of our PDB-style files is described here.)

Timeline for d3cw2d3: