![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [141310] (2 PDB entries) Uniprot Q97Z79 1-84 |
![]() | Domain d3cw2d1: 3cw2 D:1-84 [208960] Other proteins in same PDB: d3cw2c2, d3cw2c3, d3cw2d2, d3cw2d3, d3cw2g2, d3cw2g3, d3cw2h2, d3cw2h3 automated match to d2ahob2 |
PDB Entry: 3cw2 (more details), 2.8 Å
SCOPe Domain Sequences for d3cw2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw2d1 b.40.4.5 (D:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke nrkvivkvirvdrrkgtvdvslkk
Timeline for d3cw2d1: