Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) |
Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein) |
Protein eIF-2-alpha, C-terminal domain [110995] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries) Uniprot Q97Z79 176-264 |
Domain d3cw2c3: 3cw2 C:176-266 [208959] Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2d1, d3cw2d2, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2h1, d3cw2h2 automated match to d2ahob3 |
PDB Entry: 3cw2 (more details), 2.8 Å
SCOPe Domain Sequences for d3cw2c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw2c3 d.58.51.1 (C:176-266) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn pkeasealnqiisnlikigkeenvdisvvkk
Timeline for d3cw2c3: