Lineage for d3cw2c2 (3cw2 C:85-175)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329877Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) (S)
  5. 2329878Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)
  6. 2329879Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)
  7. 2329885Species Sulfolobus solfataricus [TaxId:2287] [140651] (2 PDB entries)
    Uniprot Q97Z79 85-175
  8. 2329886Domain d3cw2c2: 3cw2 C:85-175 [208958]
    Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c3, d3cw2d1, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g3, d3cw2h1, d3cw2h3
    automated match to d2ahob1

Details for d3cw2c2

PDB Entry: 3cw2 (more details), 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
PDB Compounds: (C:) Translation initiation factor 2 subunit alpha

SCOPe Domain Sequences for d3cw2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw2c2 a.60.14.1 (C:85-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]}
vtdderrkknlqwkkiqrldkilelvsqklklsekdaweqvawkleakygdpitaiekav
kegekilidagvpeiwvkplleeaskhaeer

SCOPe Domain Coordinates for d3cw2c2:

Click to download the PDB-style file with coordinates for d3cw2c2.
(The format of our PDB-style files is described here.)

Timeline for d3cw2c2: