Lineage for d3cu5b_ (3cu5 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356454Species Clostridium phytofermentans [TaxId:357809] [225451] (1 PDB entry)
  8. 1356456Domain d3cu5b_: 3cu5 B: [208954]
    automated match to d3crnb_

Details for d3cu5b_

PDB Entry: 3cu5 (more details), 2.6 Å

PDB Description: crystal structure of a two component transcriptional regulator arac from clostridium phytofermentans isdg
PDB Compounds: (B:) Two component transcriptional regulator, AraC family

SCOPe Domain Sequences for d3cu5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu5b_ c.23.1.0 (B:) automated matches {Clostridium phytofermentans [TaxId: 357809]}
slrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmpr
mdgielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsi
qtvlqhqaq

SCOPe Domain Coordinates for d3cu5b_:

Click to download the PDB-style file with coordinates for d3cu5b_.
(The format of our PDB-style files is described here.)

Timeline for d3cu5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cu5a_