Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (48 species) not a true protein |
Species Clostridium phytofermentans [TaxId:357809] [225451] (1 PDB entry) |
Domain d3cu5b_: 3cu5 B: [208954] automated match to d3crnb_ |
PDB Entry: 3cu5 (more details), 2.6 Å
SCOPe Domain Sequences for d3cu5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu5b_ c.23.1.0 (B:) automated matches {Clostridium phytofermentans [TaxId: 357809]} slrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmpr mdgielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsi qtvlqhqaq
Timeline for d3cu5b_: