Lineage for d3cu5b1 (3cu5 B:4-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855916Species Clostridium phytofermentans [TaxId:357809] [225451] (1 PDB entry)
  8. 2855918Domain d3cu5b1: 3cu5 B:4-130 [208954]
    Other proteins in same PDB: d3cu5a2, d3cu5b2
    automated match to d3crnb_

Details for d3cu5b1

PDB Entry: 3cu5 (more details), 2.6 Å

PDB Description: crystal structure of a two component transcriptional regulator arac from clostridium phytofermentans isdg
PDB Compounds: (B:) Two component transcriptional regulator, AraC family

SCOPe Domain Sequences for d3cu5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu5b1 c.23.1.0 (B:4-130) automated matches {Clostridium phytofermentans [TaxId: 357809]}
rilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmprmd
gielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsiqt
vlqhqaq

SCOPe Domain Coordinates for d3cu5b1:

Click to download the PDB-style file with coordinates for d3cu5b1.
(The format of our PDB-style files is described here.)

Timeline for d3cu5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cu5b2