SCOPe 2.08: Domain d3cu2a_: 3cu2 A:

Lineage for d3cu2a_ (3cu2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (36 species)
   not a true protein

7. Species Histophilus somni [TaxId:205914] [225448] (1 PDB entry)

8. Domain d3cu2a_: 3cu2 A: [208951]
   automated match to d2flie_
   complexed with ca, mrd, ni

Details for d3cu2a_

PDB Entry: 3cu2, 1.91 Å

PDB Description: crystal structure of ribulose-5-phosphate 3-epimerase (yp_718263.1) from haemophilus somnus 129pt at 1.91 a resolution

PDB Compounds: (A:) Ribulose-5-phosphate 3-epimerase

SCOPe Domain Sequences for d3cu2a_:

Sequence; same for both SEQRES and ATOM records:

>d3cu2a_ c.1.2.0 (A:) automated matches {Histophilus somni [TaxId: 205914]}
msklsliqqlkqqklsvgilsanwlqlneevttllenqinvlhfdiadgqfsslftvgai
gikyfpthcfkdvhlmvrnqlevakavvanganlvtlqleqyhdfaltiewlakqkttya
nqvypvligaclcpetpiselepyldqidviqlltldprngtkypselildrviqvekrl
gnrrveklinidgsmtlelakyfkqgthqidwlvsgsalfsgelktnlkvwkssi

Timeline for d3cu2a_:

• d3cu2a_ first appeared in SCOPe 2.03
  
• d3cu2a_ appears in SCOPe 2.07