Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (36 species) not a true protein |
Species Histophilus somni [TaxId:205914] [225448] (1 PDB entry) |
Domain d3cu2a_: 3cu2 A: [208951] automated match to d2flie_ complexed with ca, mrd, ni |
PDB Entry: 3cu2 (more details), 1.91 Å
SCOPe Domain Sequences for d3cu2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu2a_ c.1.2.0 (A:) automated matches {Histophilus somni [TaxId: 205914]} msklsliqqlkqqklsvgilsanwlqlneevttllenqinvlhfdiadgqfsslftvgai gikyfpthcfkdvhlmvrnqlevakavvanganlvtlqleqyhdfaltiewlakqkttya nqvypvligaclcpetpiselepyldqidviqlltldprngtkypselildrviqvekrl gnrrveklinidgsmtlelakyfkqgthqidwlvsgsalfsgelktnlkvwkssi
Timeline for d3cu2a_: