SCOP 1.61: Domain d1bbjh2: 1bbj H:116-212

Lineage for d1bbjh2 (1bbj H:116-212)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab B72.3 (mouse/human chimera), kappa L chain [48979] (1 PDB entry)

8. Domain d1bbjh2: 1bbj H:116-212 [20895]
   Other proteins in same PDB: d1bbjh1, d1bbjl1

Details for d1bbjh2

PDB Entry: 1bbj, 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

SCOP Domain Sequences for d1bbjh2:

Sequence; same for both SEQRES and ATOM records:

>d1bbjh2 b.1.1.2 (H:116-212) Immunoglobulin (constant domains of L and H chains) {Fab B72.3 (mouse/human chimera), kappa L chain}
stkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtktytcnvdhkpsntkvdkrv

Timeline for d1bbjh2:

• d1bbjh2 first appeared (with stable ids) in SCOP 1.55
  
• d1bbjh2 appears in SCOP 1.59
  
• d1bbjh2 appears in SCOP 1.63
  
• d1bbjh2 appears in the current release, SCOPe 2.08