Lineage for d3cu1a_ (3cu1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753637Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2753651Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
  8. 2753677Domain d3cu1a_: 3cu1 A: [208947]
    Other proteins in same PDB: d3cu1b_, d3cu1d_
    automated match to d3dara1

Details for d3cu1a_

PDB Entry: 3cu1 (more details), 2.6 Å

PDB Description: crystal structure of 2:2:2 fgfr2d2:fgf1:sos complex
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3cu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu1a_ b.1.1.4 (A:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv

SCOPe Domain Coordinates for d3cu1a_:

Click to download the PDB-style file with coordinates for d3cu1a_.
(The format of our PDB-style files is described here.)

Timeline for d3cu1a_: