SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ct2a2 (3ct2 A:133-374)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (72 species)
    not a true protein
  7. 2087820Species Pseudomonas fluorescens [TaxId:220664] [225447] (3 PDB entries)
  8. 2087824Domain d3ct2a2: 3ct2 A:133-374 [208942]
    Other proteins in same PDB: d3ct2a1, d3ct2a3, d3ct2b1, d3ct2b3
    automated match to d1f9ca1
    complexed with mg

Details for d3ct2a2

PDB Entry: 3ct2 (more details), 1.8 Å

PDB Description: Crystal structure of muconate cycloisomerase from Pseudomonas fluorescens
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3ct2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ct2a2 c.1.11.0 (A:133-374) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalg
dsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimade
siecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtl
asahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaff
rr

SCOPe Domain Coordinates for d3ct2a2:

Click to download the PDB-style file with coordinates for d3ct2a2.
(The format of our PDB-style files is described here.)

Timeline for d3ct2a2: