Lineage for d3ct2a1 (3ct2 A:4-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948445Species Pseudomonas fluorescens [TaxId:220664] [225446] (3 PDB entries)
  8. 2948447Domain d3ct2a1: 3ct2 A:4-132 [208941]
    Other proteins in same PDB: d3ct2a2, d3ct2a3, d3ct2b2, d3ct2b3
    automated match to d1f9ca2
    complexed with mg

Details for d3ct2a1

PDB Entry: 3ct2 (more details), 1.8 Å

PDB Description: crystal structure of muconate cycloisomerase from pseudomonas fluorescens
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3ct2a1:

Sequence, based on SEQRES records: (download)

>d3ct2a1 d.54.1.0 (A:4-132) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn
espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg
lpvsellgg

Sequence, based on observed residues (ATOM records): (download)

>d3ct2a1 d.54.1.0 (A:4-132) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
hasaiesietiivdlptinqtlvlirlrcadgieglgesttigglaygnespdsiktnid
rfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlglpvsellgg

SCOPe Domain Coordinates for d3ct2a1:

Click to download the PDB-style file with coordinates for d3ct2a1.
(The format of our PDB-style files is described here.)

Timeline for d3ct2a1: