Lineage for d3crza2 (3crz A:101-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859751Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. 2859798Species Pseudomonas aeruginosa [TaxId:287] [225369] (2 PDB entries)
  8. 2859800Domain d3crza2: 3crz A:101-258 [208940]
    Other proteins in same PDB: d3crza1
    automated match to d1a8pa2
    complexed with fad, nap

Details for d3crza2

PDB Entry: 3crz (more details), 1.9 Å

PDB Description: Ferredoxin-NADP Reductase
PDB Compounds: (A:) ferredoxin--nadp+ reductase

SCOPe Domain Sequences for d3crza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crza2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Pseudomonas aeruginosa [TaxId: 287]}
hddllpgkhlyllstgtgmapflsviqdpetyeryekvilvhgvrwvselayadfitkvl
peheyfgdqvkekliyyplvtrepfrnqgrqtdlmrsgklfediglppmnpqddramicg
spsmleetsavldsfglkisprmgepgdylierafvek

SCOPe Domain Coordinates for d3crza2:

Click to download the PDB-style file with coordinates for d3crza2.
(The format of our PDB-style files is described here.)

Timeline for d3crza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3crza1