Lineage for d1bbjl2 (1bbj L:110-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656083Domain d1bbjl2: 1bbj L:110-211 [20894]
    Other proteins in same PDB: d1bbja1, d1bbjb1, d1bbjb2, d1bbjh1, d1bbjh2, d1bbjl1
    part of humanized Fab B72.3

Details for d1bbjl2

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells
PDB Compounds: (L:) igg4-kappa b72.3 fab (light chain)

SCOP Domain Sequences for d1bbjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbjl2 b.1.1.2 (L:110-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
daaptvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1bbjl2:

Click to download the PDB-style file with coordinates for d1bbjl2.
(The format of our PDB-style files is described here.)

Timeline for d1bbjl2: