Lineage for d1bbjl2 (1bbj L:110-211)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289684Domain d1bbjl2: 1bbj L:110-211 [20894]
    Other proteins in same PDB: d1bbjh1, d1bbjh2, d1bbjl1
    part of humanized Fab B72.3

Details for d1bbjl2

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

SCOP Domain Sequences for d1bbjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbjl2 b.1.1.2 (L:110-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
daaptvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1bbjl2:

Click to download the PDB-style file with coordinates for d1bbjl2.
(The format of our PDB-style files is described here.)

Timeline for d1bbjl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbjl1