Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab B72.3 (mouse/human chimera), kappa L chain [48979] (1 PDB entry) |
Domain d1bbjl2: 1bbj L:110-211 [20894] Other proteins in same PDB: d1bbjh1, d1bbjl1 |
PDB Entry: 1bbj (more details), 3.1 Å
SCOP Domain Sequences for d1bbjl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbjl2 b.1.1.2 (L:110-211) Immunoglobulin (constant domains of L and H chains) {Fab B72.3 (mouse/human chimera), kappa L chain} daaptvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk dstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d1bbjl2: