Lineage for d1bbjl2 (1bbj L:110-211)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53658Species Fab B72.3 (mouse/human chimera), kappa L chain [48979] (1 PDB entry)
  8. 53660Domain d1bbjl2: 1bbj L:110-211 [20894]
    Other proteins in same PDB: d1bbjh1, d1bbjl1

Details for d1bbjl2

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

SCOP Domain Sequences for d1bbjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbjl2 b.1.1.2 (L:110-211) Immunoglobulin (constant domains of L and H chains) {Fab B72.3 (mouse/human chimera), kappa L chain}
daaptvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1bbjl2:

Click to download the PDB-style file with coordinates for d1bbjl2.
(The format of our PDB-style files is described here.)

Timeline for d1bbjl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbjl1