Lineage for d3crta2 (3crt A:81-214)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270526Protein Class alpha GST [81349] (8 species)
  7. 1270656Species Schistosoma japonicum [TaxId:6182] [47633] (14 PDB entries)
    Uniprot P08515
  8. 1270660Domain d3crta2: 3crt A:81-214 [208936]
    Other proteins in same PDB: d3crta1
    automated match to d1bg5a1
    complexed with gsh

Details for d3crta2

PDB Entry: 3crt (more details), 1.9 Å

PDB Description: structural characterization of an engineered allosteric protein
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d3crta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crta2 a.45.1.1 (A:81-214) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggd

SCOPe Domain Coordinates for d3crta2:

Click to download the PDB-style file with coordinates for d3crta2.
(The format of our PDB-style files is described here.)

Timeline for d3crta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3crta1