Lineage for d3crha_ (3crh A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1790653Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1790654Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1790668Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1790779Domain d3crha_: 3crh A: [208931]
    automated match to d1q03a_
    complexed with so4; mutant

Details for d3crha_

PDB Entry: 3crh (more details), 2.15 Å

PDB Description: Crystal structure of human fibroblast growth factor-1 with mutations Glu81Ser and Lys101Ala
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3crha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crha_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
ikstetgqylamdtdgllygsqtpnseclflerleenhyntyiskahaeknwfvglkkng
sckrgprthygqkailflplpv

SCOPe Domain Coordinates for d3crha_:

Click to download the PDB-style file with coordinates for d3crha_.
(The format of our PDB-style files is described here.)

Timeline for d3crha_: