Lineage for d1bbdh2 (1bbd H:120-218)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221335Species Fab 8F5 (mouse), kappa L chain [48978] (2 PDB entries)
  8. 221338Domain d1bbdh2: 1bbd H:120-218 [20893]
    Other proteins in same PDB: d1bbdh1, d1bbdl1
    complexed with so4

Details for d1bbdh2

PDB Entry: 1bbd (more details), 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2

SCOP Domain Sequences for d1bbdh2:

Sequence, based on SEQRES records: (download)

>d1bbdh2 b.1.1.2 (H:120-218) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1bbdh2 b.1.1.2 (H:120-218) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
kttapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1bbdh2:

Click to download the PDB-style file with coordinates for d1bbdh2.
(The format of our PDB-style files is described here.)

Timeline for d1bbdh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbdh1