SCOPe 2.06: Domain d3cr7c_: 3cr7 C:

Lineage for d3cr7c_ (3cr7 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein automated matches [226942] (3 species)
   not a true protein

7. Species Fungus (Penicillium chrysogenum) [TaxId:5076] [225596] (1 PDB entry)

8. Domain d3cr7c_: 3cr7 C: [208927]
   automated match to d1m7gd_
   complexed with adp, cl, pps

Details for d3cr7c_

PDB Entry: 3cr7, 2.5 Å

PDB Description: Crystal structure of N-terminal truncation of APS Kinase from Penicillium chrysogenum: Ternary structure with ADP and PAPS

PDB Compounds: (C:) Adenylyl-sulfate kinase

SCOPe Domain Sequences for d3cr7c_:

Sequence, based on SEQRES records:

>d3cr7c_ c.37.1.4 (C:) automated matches {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpv
evaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldt
kgyl

Sequence, based on observed residues (ATOM records):

>d3cr7c_ c.37.1.4 (C:) automated matches {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevtglpfvevyvdvpvevaeqr
dpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgyl

Timeline for d3cr7c_:

• d3cr7c_ first appeared in SCOPe 2.03
  
• d3cr7c_ appears in SCOPe 2.05
  
• d3cr7c_ appears in SCOPe 2.07
  
• d3cr7c_ appears in the current release, SCOPe 2.08