Lineage for d3cr7a_ (3cr7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845707Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 1845727Protein automated matches [226942] (2 species)
    not a true protein
  7. 1845728Species Fungus (Penicillium chrysogenum) [TaxId:5076] [225596] (1 PDB entry)
  8. 1845729Domain d3cr7a_: 3cr7 A: [208925]
    automated match to d1m7gd_
    complexed with adp, cl, pps

Details for d3cr7a_

PDB Entry: 3cr7 (more details), 2.5 Å

PDB Description: Crystal structure of N-terminal truncation of APS Kinase from Penicillium chrysogenum: Ternary structure with ADP and PAPS
PDB Compounds: (A:) Adenylyl-sulfate kinase

SCOPe Domain Sequences for d3cr7a_:

Sequence, based on SEQRES records: (download)

>d3cr7a_ c.37.1.4 (A:) automated matches {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
rgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrnen
irriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpve
vaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtk
gylpa

Sequence, based on observed residues (ATOM records): (download)

>d3cr7a_ c.37.1.4 (A:) automated matches {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
rgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrnen
irriaevaklfadsnsiaitsfispyrkdrdtarqlhevtglpfvevyvdvpvevaeqrd
pkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgylpa

SCOPe Domain Coordinates for d3cr7a_:

Click to download the PDB-style file with coordinates for d3cr7a_.
(The format of our PDB-style files is described here.)

Timeline for d3cr7a_: