Lineage for d3cqxb2 (3cqx B:189-381)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2884104Species Mouse (Mus musculus) [TaxId:10090] [225560] (2 PDB entries)
  8. 2884108Domain d3cqxb2: 3cqx B:189-381 [208924]
    automated match to d1ngfa2
    complexed with na, scn

Details for d3cqxb2

PDB Entry: 3cqx (more details), 2.3 Å

PDB Description: Chaperone Complex
PDB Compounds: (B:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3cqxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqxb2 c.55.1.1 (B:189-381) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d3cqxb2:

Click to download the PDB-style file with coordinates for d3cqxb2.
(The format of our PDB-style files is described here.)

Timeline for d3cqxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cqxb1