Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225560] (2 PDB entries) |
Domain d3cqxb2: 3cqx B:189-381 [208924] automated match to d1ngfa2 complexed with na, scn |
PDB Entry: 3cqx (more details), 2.3 Å
SCOPe Domain Sequences for d3cqxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cqxb2 c.55.1.1 (B:189-381) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea vaygaavqaails
Timeline for d3cqxb2: