Lineage for d3cqxb1 (3cqx B:5-188)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137589Protein automated matches [226905] (13 species)
    not a true protein
  7. 2137789Species Mouse (Mus musculus) [TaxId:10090] [225560] (1 PDB entry)
  8. 2137792Domain d3cqxb1: 3cqx B:5-188 [208923]
    automated match to d2qw9a1
    complexed with na, scn

Details for d3cqxb1

PDB Entry: 3cqx (more details), 2.3 Å

PDB Description: Chaperone Complex
PDB Compounds: (B:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3cqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqxb1 c.55.1.1 (B:5-188) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk

SCOPe Domain Coordinates for d3cqxb1:

Click to download the PDB-style file with coordinates for d3cqxb1.
(The format of our PDB-style files is described here.)

Timeline for d3cqxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cqxb2