Lineage for d3cqxa1 (3cqx A:6-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2884104Species Mouse (Mus musculus) [TaxId:10090] [225560] (2 PDB entries)
  8. 2884105Domain d3cqxa1: 3cqx A:6-188 [208921]
    automated match to d2qw9a1
    complexed with na, scn

Details for d3cqxa1

PDB Entry: 3cqx (more details), 2.3 Å

PDB Description: Chaperone Complex
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3cqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqxa1 c.55.1.1 (A:6-188) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnptn
tvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvlt
kmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiaygl
dkk

SCOPe Domain Coordinates for d3cqxa1:

Click to download the PDB-style file with coordinates for d3cqxa1.
(The format of our PDB-style files is described here.)

Timeline for d3cqxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cqxa2