Lineage for d1bbdl2 (1bbd L:115-219)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289903Domain d1bbdl2: 1bbd L:115-219 [20892]
    Other proteins in same PDB: d1bbdh1, d1bbdh2, d1bbdl1
    part of Fab 8F5
    complexed with so4

Details for d1bbdl2

PDB Entry: 1bbd (more details), 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2

SCOP Domain Sequences for d1bbdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbdl2 b.1.1.2 (L:115-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1bbdl2:

Click to download the PDB-style file with coordinates for d1bbdl2.
(The format of our PDB-style files is described here.)

Timeline for d1bbdl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbdl1