SCOPe 2.03: Domain d3coac_: 3coa C:

Lineage for d3coac_ (3coa C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (6 PDB entries)

8. Domain d3coac_: 3coa C: [208914]
   automated match to d1e17a_
   protein/DNA complex; complexed with ca

Details for d3coac_

PDB Entry: 3coa, 2.2 Å

PDB Description: crystal structure of foxo1 dbd bound to ire dna

PDB Compounds: (C:) Forkhead box protein O1

SCOPe Domain Sequences for d3coac_:

Sequence; same for both SEQRES and ATOM records:

>d3coac_ a.4.5.14 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrnawgnlsyadlitkaiessaekrltlsqiyewmvksvpyfkdkgdsnssagwknsirh
nlslhskfirvqnegtgksswwmlnp

Timeline for d3coac_:

• d3coac_ is new in SCOPe 2.03-stable
  
• d3coac_ appears in SCOPe 2.04
  
• d3coac_ appears in the current release, SCOPe 2.08