Lineage for d3cnce_ (3cnc E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776833Species Human adenovirus 16 [267755] (1 PDB entry)
  8. 2776838Domain d3cnce_: 3cnc E: [208910]
    automated match to d1h7za_

Details for d3cnce_

PDB Entry: 3cnc (more details), 2.4 Å

PDB Description: Crystal Structure of Ad16 fiber knob
PDB Compounds: (E:) fiber protein

SCOPe Domain Sequences for d3cnce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cnce_ b.21.1.1 (E:) Adenovirus fiber protein 'knob' domain {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd

SCOPe Domain Coordinates for d3cnce_:

Click to download the PDB-style file with coordinates for d3cnce_.
(The format of our PDB-style files is described here.)

Timeline for d3cnce_: